PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G225500.1
Common NameB456_001G225500, LOC105803878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 656aa    MW: 69779.8 Da    PI: 4.2097
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G225500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.14.6e-29105159155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWt+eLH+ Fve+ ++LGG+++AtPk++l+lm+++gL l hvkSHLQkYRl
  Gorai.001G225500.1 105 KPRLRWTSELHSYFVEVCNRLGGPQRATPKAVLDLMDIDGLNLFHVKSHLQKYRL 159
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25103159IPR009057Homeodomain-like
SuperFamilySSF466895.02E-14105159IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-20105160IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MGEILSELNS VSVENNVVSQ NSDEFKVSVF GEQVLAGQGD HVNGHNQHDQ QLHQGGGNNN  60
TLLALQEIPG NLPPFTVSNG DPVFGNEVVE RVREKPKLIV TNDIKPRLRW TSELHSYFVE  120
VCNRLGGPQR ATPKAVLDLM DIDGLNLFHV KSHLQKYRLG KYADKDSTEG GQTGTFGSSS  180
SAIPLPSCTN QYNRRAKRNL KNTHGELYLK LQMSIQDMGA KKLEAEMHVQ RCLEEQRRYL  240
HTALESACKT LANQYLGDAA AVENAILYGQ ASAGLGNFAT IPVGPSGFGT SATTVPPFYS  300
EQQNAYPTYS NTLTTPANLG LQEQPVGCQL QTSFSPAPQG NISTSNGYFG SSPHQETLAA  360
AAAYTDWLVD EDLIQTSFSP APQGNTSTSN GYSGSSPHQE TSAAAAAVTD WLVDEDLIQT  420
SFSPAPQGNT TSNGYSGSSP HQETLAAAAA DMDWPVDEDL IQTSFSPASQ GNISTSNGYS  480
GSSPHQETSA AAAADTDWPV DEDLIQTSFS PSPKGNISTS NGYSGSSPHQ ETSAAAAADM  540
DWPVDEDLIQ TPFSPAPQGN ISTSNGYSGS SPHQETSAAA AADTDWPVDE DLIQTSFSPA  600
PKGNISTSNG YSASSPHQET SAAAAANIDW PVDEDLIQAF FNWDDNEPMN LDASL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491750.10.0PREDICTED: uncharacterized protein LOC105803878
TrEMBLA0A0D2NCU60.0A0A0D2NCU6_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2194955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.22e-29G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]